PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0296049.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 269aa    MW: 30360 Da    PI: 9.5199
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0296049.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.54.4e-5671351129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+++yL kkv +++++  ++i+evd++k+ePw+Lp+k+k +ekewyfFs rd+ky+tg r+nrat++gyWkatgkd+e++s
  Lj0g3v0296049.1   7 LPPGFRFHPTDEELITYYLLKKVLDSTFTG-RAIAEVDLNKCEPWELPEKAKMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKATGKDREIYS 99 
                      79*************************999.89***************99999****************************************9 PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                      + + +lvg+kktLvfy+grapkgek++Wvmheyrle
  Lj0g3v0296049.1 100 SkTCSLVGMKKTLVFYRGRAPKGEKSNWVMHEYRLE 135
                      745567****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.93E-635159IPR003441NAC domain
PROSITE profilePS5100560.0357159IPR003441NAC domain
PfamPF023655.1E-298134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MNRDSHLPPG FRFHPTDEEL ITYYLLKKVL DSTFTGRAIA EVDLNKCEPW ELPEKAKMGE  60
KEWYFFSLRD RKYPTGLRTN RATEAGYWKA TGKDREIYSS KTCSLVGMKK TLVFYRGRAP  120
KGEKSNWVMH EYRLEGKFAY HYLSRNSKDE WVISRVFQKN SIGGGNGSIT TVSSTTSNGS  180
KKTRMNMNMS NTSASNSMSL CPEPSSPSSV YLPPLLDSSP YHPNNTTVIF DNNTTQREHV  240
SCFSTISAAT AAVVSNNNNT FNSNASFDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-54716117167NO APICAL MERISTEM PROTEIN
1ut4_B5e-54716117167NO APICAL MERISTEM PROTEIN
1ut7_A5e-54716117167NO APICAL MERISTEM PROTEIN
1ut7_B5e-54716117167NO APICAL MERISTEM PROTEIN
4dul_A5e-54716117167NAC domain-containing protein 19
4dul_B5e-54716117167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX3924011e-146JX392401.1 Glycine max NAC domain protein (NLP4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014500628.11e-144PREDICTED: protein CUP-SHAPED COTYLEDON 2-like
SwissprotO040171e-108NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLA0A0L9ULI41e-144A0A0L9ULI4_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SIB51e-144A0A0S3SIB5_PHAAN; Uncharacterized protein
STRINGGLYMA13G34950.11e-143(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36893463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.11e-104NAC family protein